Talk:Enaptin

From Wikipedia, the free encyclopedia
Jump to navigation Jump to search
WikiProject Molecular and Cell Biology (Rated Start-class, Low-importance)
WikiProject icon This article is within the scope of the WikiProject Molecular and Cell Biology. To participate, visit the WikiProject for more information.
Start-Class article Start  This article has been rated as Start-Class on the project's quality scale.
 Low  This article has been rated as Low-importance on the project's importance scale.
 

wow

  • Could anyone explain why the word is so long?
  • It is not a word per se, but rather a chemical code, as with other similiar substances.

Look at the crap![edit]

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

  • Are you an idiot? Did you even try reading the article? -- BRIAN0918  03:22, 30 Mar 2005 (UTC)
  • Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

Not the longest[edit]

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918  05:28, 30 Mar 2005 (UTC)

  • Alright, it's official: 189,819 letters. -- BRIAN0918  05:43, 30 Mar 2005 (UTC)

Article be cleaned up please[edit]

Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)

Removing that long word...[edit]

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)

In contrast to Titin, there are little web pages containing the full chemical name of Enaptin. Therefore, I would like to ask everybody for giving reliable web pages about it, except the following web pages:

I provide the preceding web pages for somebody who has curiosity. QQ (talk) 20:34, 17 February 2008 (UTC)

Thanks for the vandalism[edit]

Thanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918  12:58, 30 Mar 2005 (UTC)

How pitiful...[edit]

Just because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)